TMEM63B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM63B Polyclonal antibody, PBS Only (24226-1-PBS)

• 

  WB analysis using 24226-1-AP (same clone as 24226-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24226-1-AP (TMEM63B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24226-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24226-1-AP (same clone as 24226-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24226-1-AP (TMEM63B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24226-1-PBS in a different storage buffer formulation.

TMEM63B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24226-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24226-1-PBS targets TMEM63B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21573

  Product name: Recombinant human TMEM63B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 700-832 aa of BC136769

  Sequence: TMRTGFLAPTSMFTFVVLVITIVICLCHVCFGHFKYLSAHNYKIEHTETDTVDPRSNGRPPTAAAVPKSAKYIAQVLQDSEVDGDGDGAPGSSGDEPPSSSSQDEELLMPPDALTDTDFQSCEDSLIENEIHQ

• Full Name: transmembrane protein 63B
• Calculated Molecular Weight: 832 aa, 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC136769
• Gene Symbol: TMEM63B
• Gene ID (NCBI): 55362
• RRID: AB_3085727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5T3F8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM63B, also known as C6orf110, belongs to the TMEM63 family. TMEM63B is a mechanosensitive cation channel activated by hypoosmotic stress and mechanic stimulation. Genetic deletion of TMEM63B is a cause of necroptosis of outer hair cells (OHCs) and progressive hearing loss (PMID: 32375046).