TMEM66 Polyclonal antibody

• 

  IHC staining of mouse pancreas using 29599-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29599-1-AP (TMEM66 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 29599-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 29599-1-AP (TMEM66 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 29599-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29599-1-AP (TMEM66 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM66 Polyclonal Antibody for IHC, ELISA

Cat No. 29599-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

SARAF, FOAP 7, HBV XAg-transactivated protein 3, HBV X-transactivated gene 3 protein, HSPC035

---

Tested Applications

• Positive IHC detected in: mouse pancreas tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29599-1-AP targets TMEM66 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29388

  Product name: Recombinant human TMEM66 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-183 aa of BC015012

  Sequence: NDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLL

• Full Name: transmembrane protein 66
• Calculated Molecular Weight: 339 aa, 37 kDa
• GenBank Accession Number: BC015012
• Gene Symbol: TMEM66
• Gene ID (NCBI): 51669
• RRID: AB_3086144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BY9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM66/SOCE-associated regulatory factor (SARAF) is an endoplasmic reticulum (ER)-resident transmembrane protein that promotes SOCE inactivation and prevents Ca2+ overfilling of the cell. TMEM66 plays a key role in shaping cytosolic Ca2+ signals and determining the content of the major intracellular Ca2+ stores, which is probably important in protecting the cell from Ca2+ overfilling (PMID: 37007714). TMEM66 is a highly conserved protein in vertebrates. In mammals, TMEM66 is ubiquitously expressed, but has significantly high transcript levels in the immune and neuronal tissues (PMID: 25469256). Moreover, TMEM66 is an androgen-responsive marker for prostate cancer and mTOR-dependent cardiac growth (PMID:32173353).