TMEM72 Polyclonal antibody

• 

  IHC staining of human kidney using 28049-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 28049-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28049-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28049-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM72 Polyclonal Antibody for IHC, ELISA

Cat No. 28049-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, ELISA

Synonyms

bA285G1.3, C10orf127, DKFZp686M0585, KSP37, TMEM72, transmembrane protein 72

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28049-1-AP targets TMEM72 in IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21553

  Product name: Recombinant human TMEM72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-275 aa of BC127790

  Sequence: LIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF

• Full Name: transmembrane protein 72
• Calculated Molecular Weight: 275 aa, 30 kDa
• GenBank Accession Number: BC127790
• Gene Symbol: TMEM72
• Gene ID (NCBI): 643236
• RRID: AB_3086025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0PK05
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.