TMEM77 Polyclonal antibody

• 

  WB analysis of K-562 using 23182-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 23182-1-AP (TMEM77 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 23182-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 23182-1-AP (TMEM77 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary tumor using 23182-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 23182-1-AP (TMEM77 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 23182-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23182-1-AP (TMEM77 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 23182-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23182-1-AP (TMEM77 Antibody) at dilution of 1:50 (under 40x lens).

TMEM77 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23182-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

DRAM2, PRO180, RP5 1180E21.1, TMEM77, transmembrane protein 77, UNQ154/PRO180, WWFQ154

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human ovary tumor tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23182-1-AP targets TMEM77 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19711

  Product name: Recombinant human TMEM77 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 170-266 aa of BC047025

  Sequence: ALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI

• Full Name: transmembrane protein 77
• Calculated Molecular Weight: 266 aa, 30 kDa
• Observed Molecular Weight: 30 kDa, 60 kDa, 70 kDa
• GenBank Accession Number: BC047025
• Gene Symbol: TMEM77
• Gene ID (NCBI): 128338
• RRID: AB_2879225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6UX65
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.