Product Information
25988-1-AP targets TMEM93 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23114 Product name: Recombinant human TMEM93 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC001409 Sequence: MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY Predict reactive species |
| Full Name | transmembrane protein 93 |
| Calculated Molecular Weight | 110 aa, 12 kDa |
| GenBank Accession Number | BC001409 |
| Gene Symbol | TMEM93 |
| Gene ID (NCBI) | 83460 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BV81 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
