Product Information
25988-1-AP targets TMEM93 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23114 Product name: Recombinant human TMEM93 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC001409 Sequence: MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY Predict reactive species |
| Full Name | transmembrane protein 93 |
| Calculated Molecular Weight | 110 aa, 12 kDa |
| GenBank Accession Number | BC001409 |
| Gene Symbol | TMEM93 |
| Gene ID (NCBI) | 83460 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BV81 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
The TMEM93 Polyclonal antibody (Cat# 25988-1-AP) has 1 total citation. It appears in Frontiers in Genetics (2022), in a study examining the roles and clinical significances of ATF6, EMC6, and APAF1 in pancreatic cancer prognosis. The research field is oncology, specifically pancreatic cancer biomarker research. The antibody was used for Western blot and IHC on human samples.
| Species | Application | Title |
|---|---|---|
Front Genet Roles and Clinical Significances of ATF6, EMC6, and APAF1 in Prognosis of Pancreatic Cancer.
|
