TMEM97 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TMEM97 Recombinant monoclonal antibody (86837-1-RR)

• 

  WB analysis using 86837-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86837-1-RR (TMEM97 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

TMEM97 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86837-1-RR

Clone No.251796B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

MAC30, Protein MAC30, S2R, Sigma2 receptor, Sigma-2 receptor

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, MCF-7 cells, BT-549 cells, Caco-2 cells, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86837-1-RR targets TMEM97 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34803

  Product name: Recombinant human TMEM97 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-69 aa of BC045655

  Sequence: MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

• Full Name: transmembrane protein 97
• Observed Molecular Weight: 19-20 kDa
• GenBank Accession Number: BC045655
• Gene Symbol: TMEM97
• Gene ID (NCBI): 27346
• RRID: AB_3745153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5BJF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 97 (TMEM97) is an endoplasmic reticulum (ER)-residing protein that belongs to the EXPERA domain-containing family whose function is overall understudied. TMEM97 is also linked to cholesterol homeostasis, Niemann-Pick disease, Alzheimer disease, and neuropathic pain. Intriguingly, TMEM97 was recently unveiled to be the sigma-2 receptor (S2R), an enigmatic drug-binding site that had been pharmaceutically targeted for decades in treating psychotic disorders.(PMID: 39995975, PMID: 38290642)