TMIGD1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TMIGD1 Recombinant monoclonal antibody (84130-6-RR)

• 

  WB analysis using 84130-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84130-6-RR (TMIGD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse small intestine using 84130-6-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using TMIGD1 antibody (84130-6-RR, Clone: 250723F6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat small intestine using 84130-6-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using TMIGD1 antibody (84130-6-RR, Clone: 250723F6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMIGD1 Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 84130-6-RR

Clone No.250723F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, dog

Applications

WB, IF-P, ELISA

Synonyms

TMIGD, Transmembrane and immunoglobulin domain-containing protein 1, UNQ9372/PRO34164

---

Tested Applications

• Positive WB detected in: Daudi cells, HUVEC cells, Raji cells, MDCK cells
• Positive IF-P detected in: rat small intestine tissue, mouse small intestine tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84130-6-RR targets TMIGD1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat, dog samples.

• Tested Reactivity: human, mouse, rat, dog
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25691

  Product name: Recombinant human TMIGD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-207 aa of BC137201

  Sequence: VEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLD

• Full Name: transmembrane and immunoglobulin domain containing 1
• Calculated Molecular Weight: 262 aa, 29 kDa
• Observed Molecular Weight: 45 kDa, 29 kDa
• GenBank Accession Number: BC137201
• Gene Symbol: TMIGD1
• Gene ID (NCBI): 388364
• RRID: AB_3743523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6UXZ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMIGD1 (Transmembrane and immunoglobulin domain containing 1) is involved in various cellular processes such as regulation of cell structure, cell-cell adhesion, and cellular movement. It protects cells from oxidative- and nutrient-deprivation-induced cell injury by stabilizing the transepithelial electric resistance and permeability of renal epithelial cells. TMIGD1 has a calculated molecular mass of 29 kDa, and can be detected as 45 kDa due to the N-glycosylation (PMID: 26342724).