Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98263-1-RR (same clone as 98263-1-PBS)

  1x10^6 HEK-293T cells or TMIGD2/CD28H transfected HEK-293T cells were stained with 0.25 ug Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody (98263-1-RR, Clone:241807A5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98263-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98263-1-RR (same clone as 98263-1-PBS)

  1x10^6 HEK-293T cells or TMIGD2/CD28H transfected HEK-293T cells were stained with 0.25 ug Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody (98263-1-RR, Clone: 241807A5) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98263-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98263-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98263-1-RR against Human TMIGD2/CD28H were performed. The affinity constant is 171 nM.

TMIGD2/CD28H Uni-rAb^® Recombinant Antibody for FC

Cat No. 98263-1-PBS

Clone No.241807A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

TMIGD2/CD28, 241807A5, CD28 homolog, CD28H, IGPR1

---

Product Information

98263-1-PBS targets TMIGD2/CD28H in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2264

  Product name: Recombinant Human TMIGD2/CD28H protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-150 aa of BC015655

  Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

• Full Name: transmembrane and immunoglobulin domain containing 2
• Calculated Molecular Weight: 282 aa, 31 kDa
• GenBank Accession Number: BC015655
• Gene Symbol: TMIGD2
• Gene ID (NCBI): 126259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96BF3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2, also known as CD28H and IGPR1), plays a role in cell-cell interaction, migration, and angiogenesis. Through interaction with HHLA2, it costimulates T-cells in the context of TCR-mediated activation and enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade (PMID: 22419821; 23784006). TMIGD2 has been associated with several diseases, particularly in the context of cancer. It is aberrantly expressed by human AML cells and can be used to identify and enrich functional LSCs (PMID: 38167704).