TMOD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68039-1-Ig (same clone as 68039-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68039-1-Ig (TMOD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 68039-1-Ig (same clone as 68039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 68039-1-Ig (TMOD2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68039-1-PBS in a different storage buffer formulation.

TMOD2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68039-1-PBS

Clone No.1E7D1

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig, rabbit, chicken

Applications

WB, IHC, Indirect ELISA

Synonyms

N TMOD, Neuronal tropomodulin, NTMOD, TMOD2, Tropomodulin 2, tropomodulin 2 (neuronal)

---

Product Information

68039-1-PBS targets TMOD2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, pig, rabbit, chicken samples.

• Tested Reactivity: Human, pig, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7262

  Product name: Recombinant human TMOD2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-351 aa of BC064961

  Sequence: MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR

• Full Name: tropomodulin 2 (neuronal)
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 39-40 kDa
• GenBank Accession Number: BC064961
• Gene Symbol: TMOD2
• Gene ID (NCBI): 29767
• RRID: AB_2918781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NZR1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.