TMPRSS2 Recombinant monoclonal antibody, PBS Only

TMPRSS2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 80152-1-PBS
Clone No.7I5

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA

FLJ41954, PP9284, PRSS10, Serine protease 10, TMPRSS2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80152-1-PBS targets TMPRSS2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5824

Product name: Recombinant human TMPRSS2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 108-492 aa of BC051839

Sequence: FMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Predict reactive species
Full Name transmembrane protease, serine 2
Calculated Molecular Weight 54 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC051839
Gene Symbol TMPRSS2
Gene ID (NCBI) 7113
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15393
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TMPRSS2, also named as PRSS10, is a type II transmembrane serine protease which is highly expressed by the epithelium of the human prostate gland. TMPRSS2 may contribute to prostate tumor metastasis via the activation of PAR-2. TMPRSS2 is a Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions. TMPRSS2 as a host cell factor that is critical for spread of several clinically relevant viruses, including influenza A viruses and coronaviruses (PMID: 23468491, 30626688). SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. The initial spike protein priming by TMPRSS2 is essential for entry and viral spread of SARS-CoV-2 through interaction with the ACE2 receptor (PMID: 32142651, 30626688 ). Camostat mesylate, an inhibitor of TMPRSS2, can block SARS-CoV-2 infection of lung cells (PMID: 32142651). The MW of TMPRSS2 is about 65-70 kDa. It can be cleaved into some chains with MW 54 kDa, 31 kDa and 26 kDa (PMID: 25734995, 20382709, 26018085).

Loading...
||
New chat Able
正在加载,请稍候...