Featured Product
KD/KO Validated

TMPRSS3 Polyclonal antibody

TMPRSS3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17953-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

TADG12, Serine protease TADG-12, ECHOS1, EC:3.4.21.-, DFNB8

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse skin using 17953-1-AP
mouse skin tissue were subjected to SDS PAGE followed by western blot with 17953-1-AP (TMPRSS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse skin using 17953-1-AP
mouse skin tissue were subjected to SDS PAGE followed by western blot with 17953-1-AP (TMPRSS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse skin using 17953-1-AP
mouse skin tissue were subjected to SDS PAGE followed by western blot with 17953-1-AP (TMPRSS3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse skin using 17953-1-AP
mouse skin tissue were subjected to SDS PAGE followed by western blot with 17953-1-AP (TMPRSS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 17953-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 17953-1-AP (TMPRSS3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human cervical cancer using 17953-1-AP
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 17953-1-AP (TMPRSS3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin cancer using 17953-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17953-1-AP (TMPRSS3 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin cancer using 17953-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17953-1-AP (TMPRSS3 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin cancer using 17953-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17953-1-AP (TMPRSS3 antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin cancer using 17953-1-AP
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 17953-1-AP (TMPRSS3 antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMPRSS3 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse skin tissue
Positive IHC detected in	human skin cancer tissue, human cervical cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17953-1-AP targets TMPRSS3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12435 Product name: Recombinant human TMPRSS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 262-453 aa of BC074846 Sequence: LYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT Predict reactive species
Full Name	transmembrane protease, serine 3
Calculated Molecular Weight	453 aa, 49 kDa
Observed Molecular Weight	40 kDa
GenBank Accession Number	BC074846
Gene Symbol	TMPRSS3
Gene ID (NCBI)	64699
RRID	AB_2878470
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P57727
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TMPRSS3 antibody 17953-1-AP	Download protocol
WB protocol for TMPRSS3 antibody 17953-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The TMPRSS3 Polyclonal antibody (Cat# 17953-1-AP) has 2 total citations. They appear in Mol Ther Methods Clin Dev (2023), studying viral vector-mediated rescue of Tmprss3-deficient cochlea, and J Gene Med (2019), investigating TMPRSS3's role in cell viability and apoptosis in HEI-OC1 cells via circ-Slc4a2/miR-182/AKT signaling. The research fields span gene therapy, otology, and cell signaling.

Species	Application	Title
mouse	IF	Mol Ther Methods Clin Dev Selection of viral capsids and promoters affects the efficacy of rescue of Tmprss3-deficient cochlea Authors - Ksenia A Aaron KO Validated View Article
human	WB	J Gene Med TMPRSS3 regulates cell viability and apoptosis processes of HEI-OC1 cells via regulation on circ-Slc4a2, miR-182, and AKT cascade. Authors - Zhi-Wen Zhang KD Validated View Article