TMTC1 Polyclonal antibody

• 

  WB analysis of mouse bladder using 23349-1-AP

  mouse bladder tissue were subjected to SDS PAGE followed by western blot with 23349-1-AP (TMTC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 23349-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 23349-1-AP (TMTC1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 23349-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 23349-1-AP (TMTC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TMTC1 Polyclonal Antibody for WB, ELISA

Cat No. 23349-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

ARG99, OLF, TMTC1

---

Tested Applications

• Positive WB detected in: mouse bladder tissue, mouse colon tissue, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IP: See 1 publications below

Product Information

23349-1-AP targets TMTC1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19944

  Product name: Recombinant human TMTC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 426-774 aa of BC042083

  Sequence: KMYYQRALQLHPQHNRALFNLGNLLKSQEKKEEAITLLKDSIKYGPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLVDTGLPEKAVAHYQQAIKLSPSHHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQEAAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQENHDKALDAIDKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFESYRLAVQLNPDQAQAWMNMGGIQHIKGKYVSARAYYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT

• Full Name: transmembrane and tetratricopeptide repeat containing 1
• Calculated Molecular Weight: 882 aa, 99 kDa
• Observed Molecular Weight: 99 kDa, 65 kDa
• GenBank Accession Number: BC042083
• Gene Symbol: TMTC1
• Gene ID (NCBI): 83857
• RRID: AB_2879261
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUR5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IP	Cell Mol Life Sci; Notch transcriptional target tmtc1 maintains vascular homeostasis; Authors - Na Yoon Paik ; KD Validated