TMUB1 Polyclonal antibody

TMUB1 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 16638-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

C7orf21, DULP, HOPS, SB144, TMUB1, Ubiquitin like protein DULP, Ubiquitin like protein SB144, UNQ763/PRO1555

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuH-7 cells, L02 cells
Positive IF/ICC detected inL02 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16638-1-AP targets TMUB1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9988

Product name: Recombinant human TMUB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC000936

Sequence: MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

Predict reactive species
Full Name transmembrane and ubiquitin-like domain containing 1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight27 kDa, 24 kDa
GenBank Accession NumberBC000936
Gene Symbol TMUB1
Gene ID (NCBI) 83590
RRIDAB_3085503
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BVT8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane and ubiquitin-like domain-containing protein 1 (TMUB1), also referred to as hepatocyte odd protein shuttling (HOPS), is a transmembrane ubiquitin-like protein that was originally identified in the regenerated liver. HOPS is a transmembrane protein released into the cell by an enzymatic cleavage. This allows HOPS to be shuttled from the nucleus to the cytoplasm and vice versa, depending on cell cycle and environmental stress conditions. HOPS cDNA expression gives rise to the translation of three different proteins with distinct molecular weights of 27, 24 and 21 kDa, respectively.The three isoforms of HOPS are differentially expressed depending on the tissue being examined. In the brain, the shortest isoform prevails over the other, whereas in the intestine the higher molecular weight isoform prevails among the other two. Indeed, HOPS shows a different concentration of the three isoforms, which can play different cell-dependent functions. The ratio between different isoforms may vary owing to physiopathological changes in the cell (PMID:32860479).16638-1-AP can detect two bands and some literature also detected two bands (PMID:30610893, 29777440, 29967478)

Protocols

Product Specific Protocols
IF protocol for TMUB1 antibody 16638-1-APDownload protocol
WB protocol for TMUB1 antibody 16638-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...