TMX2 Recombinant monoclonal antibody

• 

  WB analysis using 87183-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87183-1-RR (TMX2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

TMX2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87183-1-RR

Clone No.252474C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cell proliferation-inducing gene 26 protein, CGI 31, CGI31, CGI-31, My009

---

Tested Applications

• Positive WB detected in: HeLa cells, HuH-7 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87183-1-RR targets TMX2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13828

  Product name: Recombinant human TMX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-296 aa of BC000666

  Sequence: PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

• Full Name: thioredoxin-related transmembrane protein 2
• Calculated Molecular Weight: 296 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000666
• Gene Symbol: TMX2
• Gene ID (NCBI): 51075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y320
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin-related transmembrane proteins (TMXs) are protein disulfide isomerase (PDI) family members and possess a transmembrane region. TMX2 cDNA was first isolated in 2003, and TMX2 mRNA has been found in a variety of human tissues, with the highest levels in the heart, brain, liver, kidney, and pancreas.