TNC/Tenascin-C Recombinant monoclonal antibody, PBS Only

• 

TNC/Tenascin-C Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83767-2-PBS

Clone No.240844D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Tenascin, TNC, Glioma-associated-extracellular matrix antigen, GMEM, GP 150 225

---

Product Information

83767-2-PBS targets TNC/Tenascin-C in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27122

  Product name: Recombinant human TNC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-200 aa of BC151843

  Sequence: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC

• Full Name: tenascin C
• Calculated Molecular Weight: 2201 aa, 241 kDa
• GenBank Accession Number: BC151843
• Gene Symbol: Tenascin C
• Gene ID (NCBI): 3371
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24821
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.