TNC/Tenascin-C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TNC/Tenascin-C Polyclonal antibody (27789-1-AP)

TNC/Tenascin-C Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 27789-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

Tenascin, TNC, Glioma-associated-extracellular matrix antigen, GMEM, GP 150 225

• 

  WB analysis using 27789-1-AP

  U-87 MG cells were subjected to SDS PAGE followed by western blot with 27789-1-AP (TNC antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 27789-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of U-87 MG using 27789-1-AP

  IP result of anti-TNC/Tenascin-C (IP:27789-1-AP, 4ug; Detection:27789-1-AP 1:3000) with U-87 MG cells lysate 1400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 27789-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 27789-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27789-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 27789-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27789-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 27789-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27789-1-AP (TNC/Tenascin-C antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TNC/Tenascin-C in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-87 MG cells
• Positive IP detected in: U-87 MG cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27789-1-AP targets TNC/Tenascin-C in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27122

  Product name: Recombinant human TNC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-200 aa of BC151843

  Sequence: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRC

• Full Name: tenascin C
• Calculated Molecular Weight: 2201 aa, 241 kDa
• Observed Molecular Weight: 210-350 kDa
• GenBank Accession Number: BC151843
• Gene Symbol: Tenascin C
• Gene ID (NCBI): 3371
• RRID: AB_2918131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24821
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation. In normal esophageal tissue, only one isoform of Tenascin-C (210 kDa) was identified, whereas at least three isoforms (210 kDa, 250 kDa, and 350 kDa) were found in esophageal cancer tissue(PMID: 26731558). It is also reported that tenascin-C exists as two isoforms of approximately 160 kDa and 280 kDa in both healthy and RA patient samples(PMID: 38077374).

Publications

What published studies show

The TNC/Tenascin-C Polyclonal antibody (Cat# 27789-1-AP) has 1 total citation. The cited publication appeared in Chin Med (Impact Factor 7.4), published in January 2025. The research field is oncology, specifically investigating how Aidi injection inhibits migration and invasion of gefitinib-resistant lung adenocarcinoma cells via the PLAT/FAK/AKT pathway. The antibody was used in Western Blot (WB) with human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Chin Med; Aidi injection inhibits the migration and invasion of gefitinib-resistant lung adenocarcinoma cells by regulating the PLAT/FAK/AKT pathway; Authors - Jingyuan Zhang