TNF beta Monoclonal antibody, PBS Only (Detector)

• 

  Sample test of MP50585-1

  Cytometric bead array of Human peripheral blood mononuclear cells (PBMC) supernatant using MP50585-1, TNF beta Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60438-1-PBS. Detection antibody: 60438-2-PBS. PBMC were cultured unstimulated or stimulated with 10 μg/mL PHA for 3 days. 50 μL of the supernatant was analyzed using MP50585-1.

• 

  Cytometric bead array standard curve of MP50585-1

  Cytometric bead array standard curve of MP50585-1, TNF Beta Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60438-1-PBS. Detection antibody: 60438-2-PBS. Standard:Eg0836. Range: 0.391-100 ng/mL.

TNF beta Monoclonal Antibody for Cytometric bead array, Indirect ELISA, Sample test

Cat No. 60438-2-PBS

Clone No.2A6C2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA, Sample test

Synonyms

LTA, TNF β, Lymphotoxin-alpha, Lymphotoxin alpha, LT alpha

---

Product Information

60438-2-PBS targets TNF beta as part of a matched antibody pair:

MP50585-1: 60438-1-PBS capture and 60438-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0836

  Product name: Recombinant Human TNF-beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 35-205 aa of BC034729

  Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

• Full Name: lymphotoxin alpha (TNF superfamily, member 1)
• Calculated Molecular Weight: 205 aa, 22 kDa
• GenBank Accession Number: BC034729
• Gene Symbol: TNF beta
• Gene ID (NCBI): 4049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A Magarose purification
• UNIPROT ID: P01374
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.