Anti-Human TNF beta Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98056-1-RR (same clone as 98056-1-PBS)

  1x10^6 untreated or anti-CD3/CD28 treated human PBMCs were intracellularly stained with 0.25 ug Anti-Human TNF beta Rabbit Recombinant Antibody (98056-1-RR, Clone: 240393C3) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG. Cells were then stained with APC Anti-Human CD3. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98056-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98056-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98056-1-RR against Human TNF Beta were performed. The affinity constant is below 1 pM.

TNF beta Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98056-1-PBS

Clone No.240393C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

LTA, 240393C3, LT alpha, Lymphotoxin alpha, Lymphotoxin-alpha

---

Product Information

98056-1-PBS targets TNF beta in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0836

  Product name: Recombinant Human TNF-beta protein (His Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 35-205 aa of BC034729

  Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

• Full Name: lymphotoxin alpha (TNF superfamily, member 1)
• Calculated Molecular Weight: 205 aa, 22 kDa
• GenBank Accession Number: BC034729
• Gene Symbol: TNF beta
• Gene ID (NCBI): 4049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01374
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNF beta also known as lymphotoxin alpha (LTA), is a member of the tumor necrosis factor family, and is a cytokine produced by lymphocytes. TNF Beta is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. TNF Beta also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis.