Use Able AI chat for product recommendations

TNF-alpha Polyclonal antibody

TNF-alpha Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26162-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Tnf, Tnfa, DIF, TNF a, TNF alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRAW 264.7 cells, LPS and Brefeldin A treated RAW 264.7 cells
Positive IF/ICC detected inLPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26162-1-AP targets TNF-alpha in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24089

Product name: Recombinant mouse Tnfa protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-235 aa of NM-013693

Sequence: MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Predict reactive species
Full Name tumor necrosis factor
Observed Molecular Weight17 kDa
GenBank Accession NumberNM-013693
Gene Symbol TNF-alpha
Gene ID (NCBI) 21926
RRIDAB_3085845
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06804
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. Mouse and human TNF-alpha share 79% amino acid sequence identity. Unlike human TNF-alpha, the mouse form is glycosylated. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles.

Protocols

Product Specific Protocols
IF protocol for TNF-alpha antibody 26162-1-APDownload protocol
WB protocol for TNF-alpha antibody 26162-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Adv Sci (Weinh)

POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling

Authors - Hang Liu
mouseWB

Cell Signal

ISG15 increases the apoptosis of β cells in type 1 diabetes

Authors - Jie Liu
mouseWB

Biochem Biophys Res Commun

Uric acid-lowering effect of harpagoside and its protective effect against hyperuricemia-induced renal injury in mice

Authors - Qiong Fu
ratWB

J Ethnopharmacol

HSYA attenuates Inflammation - Necroptosis to ameliorate secondary brain injury after intracerebral hemorrhage.

Authors - Lei Luo
mouseIF

Int J Biol Macromol

Structural characterization and multi-omics analysis of novel Saposhnikovia divaricata (Turcz.) Schischk acidic heteropolysaccharide alleviating acute liver injury.

Authors - Xialin Sun

Clin Exp Dent Res

Effect of Porphyromonas gingivalis Infection on PGC-1α in Skeletal Muscle After Endurance Training In Vivo.

Authors - Kairi Hayashi
Loading...
||
New chat

Able

正在加载,请稍候...