TNFAIP2 Polyclonal antibody

• 

  WB analysis using 25649-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25649-1-AP (TNFAIP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TNFAIP2 Polyclonal Antibody for WB, ELISA

Cat No. 25649-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

B94, TNF alpha induced protein 2, TNFAIP2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

25649-1-AP targets TNFAIP2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19150

  Product name: Recombinant human TNFAIP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 88-431 aa of BC128449

  Sequence: RQIRLLEATFLSSEAANVRELMDRALELEARRWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSHGFDTLLQNLHEDLKPLFKRFTHTRWAAPVETLENIIATVDTRLPEFSELQGCFREELMEALHLHLVKEYIIQLSKGRLVLKTAEQQQQLAGYILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSLIKVG

• Full Name: tumor necrosis factor, alpha-induced protein 2
• Calculated Molecular Weight: 654 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC128449
• Gene Symbol: TNFAIP2
• Gene ID (NCBI): 7127
• RRID: AB_2918092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03169
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFAIP2, also named as B94, belongs to the SEC6 family. TNFAIP2 may play a role as a mediator of inflammation and angiogenesis. TNFAIP2 is differentially expressed in development and capillary tube-like formation in vitro. It is induced by TNFα and other proinflammatory factors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Exp Cell Res; TGF-β-Induced Acetylation of KLF5 Drives TNFAIP2 Transcription and EMT in Nasopharyngeal Carcinoma: Unveiling a Novel Regulatory Mechanism; Authors - Yi Qian
canine	WB	Biologicals; CDC20 is a potential target gene to inhibit the tumorigenesis of MDCK cells; Authors - Zhenbin Liu
human	WB	Cell Commun Signal; NEDD4L mediates ITGB4 ubiquitination and degradation to suppress esophageal carcinoma progression; Authors - Yijun Shi