TNFAIP8L1 Polyclonal antibody

• 

  IP experiment of mouse brain using 17366-1-AP

  IP result of anti-TNFAIP8L1 (IP:17366-1-AP, 4ug; Detection:17366-1-AP 1:500) with mouse brain tissue lysate 1720 ug.

TNFAIP8L1 Polyclonal Antibody for IP, ELISA

Cat No. 17366-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, ELISA

Synonyms

Oxidative stress-regulated gene-beta, Oxy-beta, TIPE1, TNF alpha-induced protein 8-like protein 1, TNFAIP8-like protein 1

---

Tested Applications

• Positive IP detected in: mouse brain tissue

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17366-1-AP targets TNFAIP8L1 in IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10778

  Product name: Recombinant human TNFAIP8L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of BC017672

  Sequence: MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAVGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

• Full Name: tumor necrosis factor, alpha-induced protein 8-like 1
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC017672
• Gene Symbol: TNFAIP8L1
• Gene ID (NCBI): 126282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVP5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFAIP8L1, also known as TIPE1, is a member of the TNFAIP8 family. TNFAIP8L1 possesses anti-apoptotic and pro-tumorigenic properties, which are crucial for tumor initiation and progression as well as the immune system's ability to combat cancer. TNFAIP8L1 is highly expressed in most cancer cell lines, particularly in cells transformed by viral genomes. The calculated molecular weight of TNFAIP8L1 is 21 kDa. (PMID: 36254562, PMID: 38065896, PMID: 21600655)