TNF beta Polyclonal antibody

• 

  IHC staining of human malignant melanoma using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human malignant melanoma using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 40x lens).

TNF beta Polyclonal Antibody for IHC, ELISA

Cat No. 13111-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

LTA, LT alpha, TNFB, TNF β, Lymphotoxin-alpha

---

Tested Applications

• Positive IHC detected in: human malignant melanoma tissue, human testis tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 3 publications below

Product Information

13111-1-AP targets TNF beta in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3775

  Product name: Recombinant human TNFB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-205 aa of BC034729

  Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

• Full Name: lymphotoxin alpha (TNF superfamily, member 1)
• Calculated Molecular Weight: 205 aa, 22 kDa
• GenBank Accession Number: BC034729
• Gene Symbol: TNF beta
• Gene ID (NCBI): 4049
• RRID: AB_2877916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01374
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Sci (Weinh); Plac1+ Tumor Cell-Treg Interplay Supports Tumorigenesis and Progression of Head and Neck Cancer; Authors - Xiaoyan Meng
human	IF	Diagnostics (Basel); Loss of Lymphotoxin Alpha-Expressing Memory B Cells Correlates with Metastasis of Human Primary Melanoma.; Authors - Franziska Werner
mouse	WB	Phytomedicine; Glycosides from Buyang Huanwu Decoction inhibit atherosclerotic inflammation via JAK/STAT signaling pathway; Authors - Xinying Fu
human	IF	Br J Cancer; Machine learning for the identification of neoantigen-reactive CD8 + T cells in gastrointestinal cancer using single-cell sequencing; Authors - Hongwei Sun
		Microbiol Res; Androgen deficiency-induced loss of Lactobacillus salivarius extracellular vesicles is associated with the pathogenesis of osteoporosis; Authors - Wenjun Zhang