TNF beta Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TNF beta Polyclonal antibody (13111-1-AP)

TNF beta Polyclonal Antibody for IHC, ELISA

Cat No. 13111-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

LTA, LT alpha, TNFB, TNF β, Lymphotoxin-alpha

• 

  IHC staining of human malignant melanoma using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 13111-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 13111-1-AP (TNF beta antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TNF beta in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human malignant melanoma tissue, human testis tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13111-1-AP targets TNF beta in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3775

  Product name: Recombinant human TNFB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 35-205 aa of BC034729

  Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

• Full Name: lymphotoxin alpha (TNF superfamily, member 1)
• Calculated Molecular Weight: 205 aa, 22 kDa
• GenBank Accession Number: BC034729
• Gene Symbol: TNF beta
• Gene ID (NCBI): 4049
• RRID: AB_2877916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01374
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TNF beta polyclonal antibody (Cat# 13111-1-AP) has 6 citations published in Advanced Science, Phytomedicine, Microbiology Research, British Journal of Cancer, Diagnostics, and BMC Immunology. Research fields span head and neck cancer, atherosclerotic inflammation, osteoporosis microbiome, gastrointestinal cancer immunology, melanoma metastasis, and pituitary neuroendocrine tumor. Applications cited include WB and IF in human and mouse models.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Sci (Weinh); Plac1+ Tumor Cell-Treg Interplay Supports Tumorigenesis and Progression of Head and Neck Cancer; Authors - Xiaoyan Meng
mouse	WB	Phytomedicine; Glycosides from Buyang Huanwu Decoction inhibit atherosclerotic inflammation via JAK/STAT signaling pathway; Authors - Xinying Fu
		Microbiol Res; Androgen deficiency-induced loss of Lactobacillus salivarius extracellular vesicles is associated with the pathogenesis of osteoporosis; Authors - Wenjun Zhang
human	IF	Br J Cancer; Machine learning for the identification of neoantigen-reactive CD8 + T cells in gastrointestinal cancer using single-cell sequencing; Authors - Hongwei Sun
human	IF	Diagnostics (Basel); Loss of Lymphotoxin Alpha-Expressing Memory B Cells Correlates with Metastasis of Human Primary Melanoma.; Authors - Franziska Werner
		BMC Immunol; Peripheral immune signatures associated with invasive behavior in pituitary neuroendocrine tumor: a blood-based analysis.; Authors - Hongyu Liu