TNFR1/CD120a Monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP50042-1

  Sandwich ELISA standard curve of MP50042-1, TNFR1/CD120a Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68685-1-PBS. Detection antibody: 68685-2-PBS. Standard: Eg0531. Range: 7.8-500 pg/mL.

• 

  Sample test of MP50042-1

  Serum of sixteen individual healthy human donors was measured. The TNFR1/CD120a concentration of detected samples was determined to be 1,779.9 pg/mL with a range of 976.2-2,358.9 pg/mL.

• 

  Sample test of MP50042-1

  Urine of eight individual healthy human donors was measured. The TNFR1/CD120a concentration of detected samples was determined to be 1,147.7 pg/mL with a range of 373.1-2,123.2 pg/mL.

• 

  Sample test of MP50042-1

  Human peripheral blood mononuclear cells (PBMC) were cultured unstimulated or stimulated with 10 μg/mL PHA for 3 days. The mean TNFR1/CD120a concentration was determined to be 8.1 pg/mL in unstimulated PBMC supernatant, 76.0 pg/mL in PHA stimulated PBMC supernatant.

TNFR1/CD120a Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 68685-1-PBS

Clone No.1E3E4

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD120a, TNFR1, TNFRSF1A, FPF, p55

---

Product Information

68685-1-PBS targets TNFR1/CD120a as part of a matched antibody pair:

MP50042-1: 68685-1-PBS capture and 68685-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0531

  Product name: Recombinant Human TNFR1/CD120a protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 22-211 aa of BC010140

  Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

• Full Name: tumor necrosis factor receptor superfamily, member 1A
• Calculated Molecular Weight: 455 aa, 50 kDa
• GenBank Accession Number: BC010140
• Gene Symbol: TNFR1
• Gene ID (NCBI): 7132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19438
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.