TNFR2 Polyclonal antibody

TNFR2 Polyclonal Antibody for ELISA
Cat No. 14478-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

CD120b, Etanercept, p75, p75TNFR, p80 TNF alpha receptor, TBP 2, TBPII, TNF R II, TNF R2, TNF R75, TNF Receptor 2, TNF Receptor II, TNF RII, TNFBR, TNFR II, TNFR1B, TNFR2, TNFR80, TNFRSF1B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14478-1-AP targets TNFR2 in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5858

Product name: Recombinant human TNFR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 38-282 aa of BC052977

Sequence: STCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCV

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 1B
Calculated Molecular Weight 48 kDa
GenBank Accession NumberBC052977
Gene Symbol TNFR2
Gene ID (NCBI) 7133
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20333
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tumor necrosis factor-alpha (TNFA/TNFSF2) is amultifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNFA signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a) and TNFR2 (TNFRSF1B, CD120b). TNFR1 is widely expressed, whereas TNFR2 exhibits more restricted expression, being found on CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells (PMID: 20489699; 22374304). In contrast to TNFR1, TNFR2 does not have a death domain. TNFR2 only signals for antiapoptotic reactions. However, recent evidence indicates that TNFR2 also signals to induce TRAF2 degradation (PMID: 22374304). Various defects in the TNFR2 pathway, due to polymorphisms in the TNFR2 gene, upregulated expression of TNFR2 and TNFR2 shedding, have been implicated in the pathology of several autoimmune disorders (PMID: 20489699).

Loading...
||
New chat Able
正在加载,请稍候...