TNFR2/CD120b Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83101-4-PBS

  Biolayer interferometry (BLl) kinetic assays of 83101-4-PBS against Human TNFR2 were performed. The affinity constant is 3.77 nM.

TNFR2/CD120b Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83101-4-PBS

Clone No.230328F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

TNFRSF1B, CD120b, Etanercept, p75, p75TNFR

---

Product Information

83101-4-PBS targets TNFR2/CD120b in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0086

  Product name: Recombinant Human TNFR2/CD120b protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 23-257 aa of BC052977

  Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

• Full Name: tumor necrosis factor receptor superfamily, member 1B
• Calculated Molecular Weight: 48 kDa
• GenBank Accession Number: BC052977
• Gene Symbol: TNFR2
• Gene ID (NCBI): 7133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20333
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.