Anti-Human TNFR2/CD120b Rabbit Recombinant Antibody, PBS Only

TNFR2/CD120b Uni-rAb® Recombinant Antibody for
Cat No. 98010-1-PBS
Clone No.230328B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

TNFRSF1B, 230328B3, CD120b, Etanercept, p75

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98010-1-PBS targets TNFR2/CD120b in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0086

Product name: Recombinant Human TNFR2/CD120b protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 23-257 aa of BC052977

Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 1B
Calculated Molecular Weight 48 kDa
GenBank Accession NumberBC052977
Gene Symbol TNFR2
Gene ID (NCBI) 7133
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20333
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C. Stable for one year after shipment.

Background Information

Tumor necrosis factor-alpha (TNFA/TNFSF2) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNFA signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a, p55) and TNFR2 (TNFRSF1B, CD120b, p75). TNFR1 is widely expressed, whereas TNFR2 exhibits more restricted expression, being found on CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells (PMID: 20489699; 22374304). In contrast to TNFR1, TNFR2 does not have a death domain. TNFR2 only signals for antiapoptotic reactions. However, recent evidence indicates that TNFR2 also signals to induce TRAF2 degradation (PMID: 22374304). Various defects in the TNFR2 pathway, due to polymorphisms in the TNFR2 gene, upregulated expression of TNFR2 and TNFR2 shedding, have been implicated in the pathology of several autoimmune disorders (PMID: 20489699).

Loading...
||
New chat Able
正在加载,请稍候...