Product Information
98439-2-PBS targets TNFRSF13B/CD267 in FC applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1814 Product name: Recombinant Mouse TNFRSF13B/CD267 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 5-128 aa of NM_021349.1 Sequence: FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYC Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 13b |
| Calculated Molecular Weight | 27 kDa |
| GenBank Accession Number | NM_021349.1 |
| Gene Symbol | Tnfrsf13b |
| Gene ID (NCBI) | 57916 |
| RRID | AB_3746077 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9ET35 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13/APRIL/CD256 and TNFSF13B/BAFF/CD257 and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.
