CD268/BAFF-R Monoclonal antibody, PBS Only (Detector)

CD268/BAFF-R Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60763-4-PBS
Clone No.2E8E12

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

TNFRSF13C, B-cell-activating factor receptor, BAFF-R, BAFFR, BAFF receptor

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60763-4-PBS targets CD268/BAFF-R as part of a matched antibody pair:

MP51091-3: 60763-2-PBS capture and 60763-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18512

Product name: Recombinant human TNFRSF13C protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-184 aa of BC105123

Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 13C
Calculated Molecular Weight 184 aa, 19 kDa
GenBank Accession NumberBC105123
Gene Symbol TNFRSF13C
Gene ID (NCBI) 115650
Conjugate Unconjugated
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDQ96RJ3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

B-cell-activating factor receptor (BAFF-R, also known as CD268 and TNFRSF13C) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It is expressed in most malignant B cells, including those in primary central nervous system lymphoma (PCNSL), and is involved in the survival and proliferation of these cells (PMID: 32528875). The interaction of BAFF with BAFF-R promotes NF-κB activation, which plays a crucial role in B-cell maturation, survival, and costimulation of T-cell activation and proliferation (PMID: 30349534). Additionally, BAFF-R is associated with chronic kidney disease (CKD) by activating NF-κB signaling in renal tubular epithelial cells (PMID: 38791453).

Loading...
||
New chat Able
正在加载,请稍候...