BCMA/TNFRSF17 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01305-4

  Sandwich ELISA standard curve of MP01305-4, Human TNFRSF17 Recombinant Matched Antibody Pair - PBS only. 84419-6-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1812. 84419-1-PBS was HRP conjugated as the detection antibody. Range: 31.3-2000 pg/mL

• 

  Sample test of MP01305-4

  Plasma of six individual healthy human donors was measured. The human TNFRSF17 concentration of detected samples was determined to be 22.27 ng/mL with a range of 16.36 - 27.02 ng/mL.

• 

  Sample test of MP01305-4

  Saliva of six individual healthy human donors was measured. The human TNFRSF17 concentration of detected samples was determined to be 306.6 pg/mL with a range of 134.5 - 422.1 pg/mL.

• 

  Sample test of MP01305-4

  Urine of six individual healthy human donors was measured. The human TNFRSF17 concentration of detected samples was determined to be 4,148.4 pg/mL with a range of 2,044.1 - 6,691.8 pg/mL.

• 

  Sample test of MP01305-4

  Serum of six individual healthy human donors was measured. The human TNFRSF17 concentration of detected samples was determined to be 27.48 ng/mL with a range of 23.83 - 30.35 ng/mL.

BCMA/TNFRSF17 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84419-1-PBS

Clone No.241731A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

TNFRSF17, B-cell maturation protein, BCM, BCMA, CD269

---

Product Information

84419-1-PBS targets BCMA/TNFRSF17 as part of a matched antibody pair:

MP01305-4: 84419-6-PBS capture and 84419-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1812

  Product name: Recombinant Human TNFRSF17 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-54 aa of BC058291

  Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

• Full Name: tumor necrosis factor receptor superfamily, member 17
• Calculated Molecular Weight: 184 aa, 20 kDa
• GenBank Accession Number: BC058291
• Gene Symbol: TNFRSF17
• Gene ID (NCBI): 608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q02223
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.