Use Able AI chat for product recommendations

TNFSF11/RANKL Recombinant monoclonal antibody, PBS Only

TNFSF11/RANKL Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85321-2-PBS
Clone No.251930C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

TNFSF11, CD 254, CD254, Receptor activator of nuclear factor kappa-B ligand, TNF-related activation-induced cytokine

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85321-2-PBS targets TNFSF11/RANKL in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2564

Product name: Recombinant Human TNFSF11/RANKL protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 64-245 aa of NM_003701

Sequence: GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 11
Calculated Molecular Weight28KD
Observed Molecular Weight35 kDa
GenBank Accession NumberNM_003701
Gene Symbol RANKL
Gene ID (NCBI) 8600
RRIDAB_3744134
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14788
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.

Loading...
||
New chat

Able

正在加载,请稍候...