TNFSF12 Polyclonal antibody

• 

  WB analysis of HEK-293 using 12537-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12537-1-AP (TNFSF12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDA-MB-453s using 12537-1-AP

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 12537-1-AP (TNFSF12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 12537-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12537-1-AP (TNFSF12 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

TNFSF12 Polyclonal Antibody for WB, ELISA

Cat No. 12537-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, ELISA

Synonyms

APO3 ligand, APO3L, DR3LG, TNFSF12, TWEAK

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MDA-MB-453s cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

12537-1-AP targets TNFSF12 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3242

  Product name: Recombinant human TNFSF12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC019047

  Sequence: MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP

• Full Name: tumor necrosis factor (ligand) superfamily, member 12
• Calculated Molecular Weight: 330 aa, 37 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC019047
• Gene Symbol: TNFSF12
• Gene ID (NCBI): 8742
• RRID: AB_2206217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Commun; Endothelial AGGF1 promotes retinal angiogenesis by coordinating TNFSF12/FN14 signalling; Authors - Ying Cheng ; KD Validated