TNFSF18 Polyclonal antibody

• 

  WB analysis using 23899-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 23899-1-AP (TNFSF18 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 23899-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 23899-1-AP (TNFSF18 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 23899-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 23899-1-AP (TNFSF18 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 23899-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 23899-1-AP (TNFSF18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 23899-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 23899-1-AP (TNFSF18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 23899-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 23899-1-AP (TNFSF18 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 23899-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 23899-1-AP (TNFSF18 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TNFSF18 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23899-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

AITRL, GITRL, hGITRL, TL6, TNFSF18

---

Tested Applications

• Positive WB detected in: SGC-7901 cells
• Positive IHC detected in: human thyroid cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:500
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 2 publications below
• FC: See 1 publications below

Product Information

23899-1-AP targets TNFSF18 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20979

  Product name: Recombinant human TNFSF18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-177 aa of BC069319

  Sequence: MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

• Full Name: tumor necrosis factor (ligand) superfamily, member 18
• Calculated Molecular Weight: 177 aa, 20 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC069319
• Gene Symbol: TNFSF18
• Gene ID (NCBI): 8995
• RRID: AB_2879355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNG2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF,FC	Cell Death Dis; GITR/GITRL reverse signalling modulates the proliferation of hepatic progenitor cells by recruiting ANXA2 to phosphorylate ERK1/2 and Akt.; Authors - Yu He
mouse	IF	Cell Death Dis; GITRL impairs hepatocyte repopulation by liver progenitor cells to aggravate inflammation and fibrosis by GITR+CD8+ T lymphocytes in CDE Mice; Authors - Li Li
human	IHC	Am J Surg Pathol; High FCGR2B Expression Can Identify Low-tumor-burden Follicular Lymphoma Patients Who Do Not Require Any Antilymphoma Therapy for a Long Term; Authors - Shotaro Watanabe