Anti-Human TNFSF18 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of HUVEC using 98403-3-RR (same clone as 98403-3-PBS)

  1x10^6 HUVEC cells (left), Jurkat cells (middle) or Raji cells (right) were surface stained with 0.25 ug Anti-Human TNFSF18 Rabbit RecAb (98403-3-RR, Clone: 250008B9) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-2-RR, Clone: 240953A11) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98403-3-PBS in a different storage buffer formulation.

TNFSF18 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98403-3-PBS

Clone No.250008B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

Activation-inducible TNF-related ligand, AITRL, GITRL, Glucocorticoid-induced TNF-related ligand, hGITRL

---

Product Information

98403-3-PBS targets TNFSF18 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32094

  Product name: Recombinant Human TNFSF18 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 50-177 aa of BC069319

  Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

• Full Name: tumor necrosis factor (ligand) superfamily, member 18
• Calculated Molecular Weight: 177 aa, 20 kDa
• GenBank Accession Number: BC069319
• Gene Symbol: TNFSF18
• Gene ID (NCBI): 8995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UNG2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells.