TNK1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86190-2-RR (same clone as 86190-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86190-2-RR (TNK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86190-2-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 86190-2-RR (same clone as 86190-2-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 86190-2-RR (TNK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86190-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86190-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86190-2-RR against Human TNK1 were performed. The affinity constant is below 1 pM.

TNK1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86190-2-PBS

Clone No.250786A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.10.2, Non-receptor tyrosine-protein kinase TNK1

---

Product Information

86190-2-PBS targets TNK1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5402

  Product name: Recombinant human TNK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-377 aa of BC035782

  Sequence: MLPEAGSLWLLKLLRDIQLAQFYWPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLSEALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPRHLPEPEGGLKCLIPEGAVCRGELLGSGCFGVVHRGLWTLPSGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHVLRLHGLVLGQPLQMVMELAPLGSLHARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARGLVHRDLATRNLLLASPRTIKVADFGLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCWAPHPADRPSFSHLEGLL

• Full Name: tyrosine kinase, non-receptor, 1
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC035782
• Gene Symbol: TNK1
• Gene ID (NCBI): 8711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13470
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.