TNKS Polyclonal antibody

• 

  WB analysis of HeLa using 18030-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18030-1-AP (TNKS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 18030-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 18030-1-AP (TNKS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 18030-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 18030-1-AP (TNKS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 18030-1-AP

  IP result of anti-TNKS (IP:18030-1-AP, 4ug; Detection:18030-1-AP 1:500) with Jurkat cells lysate 3200ug.

• 

  IHC staining of mouse testis using 18030-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18030-1-AP (TNKS antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 18030-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 18030-1-AP (TNKS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 18030-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18030-1-AP (TNKS antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 18030-1-AP

  Immunofluorescent analysis of HepG2 cells, using TNKS antibody 18030-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• Featured Product
• KD/KO Validated

TNKS Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18030-1-AP

Publications(11)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PARP5A, PARP 5a, EC:2.4.2.30, EC:2.4.2.-, ARTD5

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: mouse testis tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

18030-1-AP targets TNKS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12597

  Product name: Recombinant human TNKS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-329 aa of BC098394

  Sequence: MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDQVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAV

• Full Name: tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase
• Calculated Molecular Weight: 1327 aa, 142 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC098394
• Gene Symbol: TNKS
• Gene ID (NCBI): 8658
• RRID: AB_2303564
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95271
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Mol Cell; PARP5A and RNF146 phase separation restrains RIPK1-dependent necroptosis; Authors - Shouqiao Hou
		J Biol Chem; The dePARylase NUDT16 promotes radiation resistance of cancer cells by blocking SETD3 for degradation via reversing its ADP-ribosylation; Authors - Weijun Wu
Mouse		J Cell Sci; Knockout of Syntaxin-4 in 3T3-L1 adipocytes reveals new insight into GLUT4 trafficking and adiponectin secretion.; Authors - Hannah L Black
human	IHC, WB, IF	Oncol Lett; Dihydroartemisinin suppresses proliferation, migration, the Wnt/β-catenin pathway and EMT via TNKS in gastric cancer.; Authors - Yanmei Ma
human	WB,IHC	Cell Death Dis; circ5615 functions as a ceRNA to promote colorectal cancer progression by upregulating TNKS.; Authors - Zhifei Ma ; KD Validated
human	WB	Adv Sci (Weinh); Transferrin Receptor-Mediated Iron Uptake Promotes Colon Tumorigenesis; Authors - Hyeoncheol Kim

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Aditya (Verified Customer) (06-16-2025)

working with a hek lysate western blot, did not get any banding in the predicted protein range specified by proteintech - cut the blot to only have this region, may have run over or under and i wouldnt be able to tell

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000