TNNI2 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 22130-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22130-1-AP (TNNI2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22130-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22130-1-AP (TNNI2 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 22130-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22130-1-AP (TNNI2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 22130-1-AP

  IP result of anti-TNNI2 (IP:22130-1-AP, 4ug; Detection:22130-1-AP 1:500) with mouse skeletal muscle tissue lysate 4000ug.

• 

  IHC staining of human skeletal muscle using 22130-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 22130-1-AP (TNNI2 Antibody) at dilution of 1:50.

• 

  IHC staining of mouse skeletal muscle using 22130-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 22130-1-AP (TNNI2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse skeletal muscle using 22130-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using TNNI2 antibody (22130-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse skeletal muscle using 22130-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using TNNI2 antibody (22130-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

TNNI2 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22130-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

Troponin I fast skeletal muscle

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

22130-1-AP targets TNNI2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17750

  Product name: Recombinant human TNNI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC032148

  Sequence: MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDL

• Full Name: troponin I type 2 (skeletal, fast)
• Calculated Molecular Weight: 182 aa, 21 kDa
• Observed Molecular Weight: 21-26 kDa
• GenBank Accession Number: BC032148
• Gene Symbol: TNNI2
• Gene ID (NCBI): 7136
• RRID: AB_2879002
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48788
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Ann Surg Oncol; Troponin I2 as a Specific Biomarker for Prediction of Peritoneal Metastasis in Gastric Cancer.; Authors - Koichi Sawaki
mouse	WB	Sci Rep; A missense mutation in the RSRSP stretch of Rbm20 causes dilated cardiomyopathy and atrial fibrillation in mice.; Authors - Kensuke Ihara
mouse	WB	Front Physiol; Lipidomic Analyses Reveal Specific Alterations of Phosphatidylcholine in Dystrophic Mdx Muscle.; Authors - William J Valentine
mouse	WB	J Muscle Res Cell Motil; Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes.; Authors - Nagakatsu Harada