Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22130-1-AP targets TNNI2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17750 Product name: Recombinant human TNNI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC032148 Sequence: MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDL Predict reactive species |
| Full Name | troponin I type 2 (skeletal, fast) |
| Calculated Molecular Weight | 182 aa, 21 kDa |
| Observed Molecular Weight | 21-26 kDa |
| GenBank Accession Number | BC032148 |
| Gene Symbol | TNNI2 |
| Gene ID (NCBI) | 7136 |
| RRID | AB_2879002 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48788 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNNI2 antibody 22130-1-AP | Download protocol |
| IHC protocol for TNNI2 antibody 22130-1-AP | Download protocol |
| IP protocol for TNNI2 antibody 22130-1-AP | Download protocol |
| WB protocol for TNNI2 antibody 22130-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TNNI2 Polyclonal antibody (Cat# 22130-1-AP) has 4 total citations published in Scientific Reports, Frontiers in Physiology, Annals of Surgical Oncology, and Journal of Muscle Research and Cell Motility. The associated research fields include cardiomyopathy and atrial fibrillation, lipidomics in dystrophic muscle, gastric cancer biomarker prediction, and unfolded protein response regulation in myotubes.
| Species | Application | Title |
|---|---|---|
Sci Rep A missense mutation in the RSRSP stretch of Rbm20 causes dilated cardiomyopathy and atrial fibrillation in mice. | ||
Front Physiol Lipidomic Analyses Reveal Specific Alterations of Phosphatidylcholine in Dystrophic Mdx Muscle. | ||
Ann Surg Oncol Troponin I2 as a Specific Biomarker for Prediction of Peritoneal Metastasis in Gastric Cancer. | ||
J Muscle Res Cell Motil Differential regulation of Actn2 and Actn3 expression during unfolded protein response in C2C12 myotubes. |
