TNRC18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TNRC18 Polyclonal antibody, PBS Only (32165-1-PBS)

• 

  WB analysis using 32165-1-AP (same clone as 32165-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32165-1-AP (TNRC18 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32165-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32165-1-AP (same clone as 32165-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32165-1-AP (TNRC18 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32165-1-PBS in a different storage buffer formulation.

TNRC18 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32165-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Trinucleotide repeat-containing gene 18 protein, Trinucleotide Repeat Containing 18, Long CAG trinucleotide repeat-containing gene 79 protein, KIAA1856, CAGL79

---

Product Information

32165-1-PBS targets TNRC18 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37483

  Product name: Recombinant human TNRC18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1238-1400 aa of BC131808

  Sequence: PCTAALDLGVQLTPETLVEAKEEPVEVPVAVPVVEAVPEEGLAQVAPSESQPTLEMSDCDVPAGEGQCPSLEPQEAVPVLGSTCFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLPSPGAAGAQALEKLEAAESLVLEQSFLHGITLLSEIAELELER

• Full Name: trinucleotide repeat containing 18
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC131808
• Gene Symbol: TNRC18
• Gene ID (NCBI): 84629
• RRID: AB_3670212
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O15417
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Trinucleotide repeat containing 18 (TNRC18, also known as CAGL79 and KIAA1856) is a nucleic-acid-binding protein, which recognizes H3K9me3 to mediate the silencing of ERV class I (ERV1) elements and acts as a chromatin-associated regulator of ERVs (PMID: 27980689; 37938770). It is located in the cytosol, mitochondrion, and nucleus (PMID: 19262598). The mutation in TNRC18 may cause Fazio-Londe disease (PMID: 38188848).