TOAG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TOAG1 Polyclonal antibody (21564-1-AP)

• Featured Product
• KD/KO Validated

TOAG1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21564-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C3orf23, TCAIM, T-cell activation inhibitor, T-cell activation inhibitor, mitochondrial, TOAG-1

• 

  WB analysis of HEK-293 using 21564-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21564-1-AP (TOAG1 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21564-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21564-1-AP (TOAG1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21564-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21564-1-AP (TOAG1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TOAG1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21564-1-AP targets TOAG1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16067

  Product name: Recombinant human C3orf23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 147-496 aa of BC101060

  Sequence: TQPLKEAKRMPDRPIKWDKSYYSFTGFKDPDEDLEQVSRVETTLTSWLDNNGKSAVKKLKNSLPLRKELDRLKDELSHQLQLSDIRWQRSWGIAHRCSQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVGHVMLGTMDVHHHWTKLFERLPSYFDLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYNRLLKSRILFHPRSLRGLQMILNSDRYAPSLHELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKVIENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRLLEQSLPYLHGMHLCISHFYSVMQDGDLCIPWNWKNGEAIK

• Full Name: chromosome 3 open reading frame 23
• Calculated Molecular Weight: 496 aa, 58 kDa
• Observed Molecular Weight: 35-41 kDa
• GenBank Accession Number: BC101060
• Gene Symbol: TOAG1
• Gene ID (NCBI): 285343
• RRID: AB_2878885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3R3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOAG1, also named as TCAIM and C3orf23, is a mitochondrial protein which regulates T-cell apoptosis. It is a specific and reproducible marker for quiescence. TOAG1 has two isoforms with MW 41 kDa and 58 kDa.

Publications

What published studies show

The TOAG1 Polyclonal antibody (Cat# 21564-1-AP) has 1 citation. It appears in FEBS Journal (IF 4.2), in a 2022 study investigating the role of TCAIM in suppressing renal carcinoma growth and enhancing sensitivity to sunitinib. The research field is oncology, specifically renal cell carcinoma. The application cited is IHC in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	FEBS J; A novel role of TCAIM: suppressing renal carcinoma growth and enhancing its sensitivity to sunitinib; Authors - Zhuo Ye ; KD Validated