TOM20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TOM20 Polyclonal antibody, PBS Only (11802-1-PBS)

• Featured Product
• KD/KO Validated

TOM20 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11802-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, chicken

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

TOMM20, KIAA0016, MAS20, MOM19, tom 20

• 

  WB analysis using 11802-1-AP (same clone as 11802-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11802-1-AP (TOM20 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 11802-1-AP (same clone as 11802-1-PBS)

  WB result of TOM20 antibody (11802-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TOM20 transfected HEK-293 cells. This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11802-1-AP (same clone as 11802-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11802-1-AP (TOM20 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11802-1-AP (same clone as 11802-1-PBS)

  IP result of anti-TOM20 (IP:11802-1-AP, 4ug; Detection:11802-1-AP 1:6000) with HeLa cells lysate 1085 ug. This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11802-1-AP (same clone as 11802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 11802-1-AP (TOM20 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HUVEC using 11802-1-AP (same clone as 11802-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using TOM20 antibody (11802-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 11802-1-AP (same clone as 11802-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using TOM20 antibody (11802-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11802-1-AP (same clone as 11802-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TOM20 antibody (11802-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11802-1-AP (same clone as 11802-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 11802-1-AP (TOM20 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 11802-1-AP (same clone as 11802-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug TOM20 Polyclonal antibody (11802-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 11802-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TOM20 in ?

Chat with Able

---

Product Information

11802-1-PBS targets TOM20 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, chicken samples.

• Tested Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2378

  Product name: Recombinant human TOM20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC000882

  Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

• Full Name: translocase of outer mitochondrial membrane 20 homolog (yeast)
• Calculated Molecular Weight: 145 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC000882
• Gene Symbol: TOM20
• Gene ID (NCBI): 9804
• RRID: AB_2207530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15388
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Background

 TOM20 (KIAA0016) belongs to the Tom family. It is a subunit of the mitochondrial import receptor (PMID: 7584026), whose main role is to translocate cytosolically synthesized mitochondrial proteins through the outer mitochondrial membrane and subsequently facilitate the movement of proteins into the TOM40 translocation pore complex (PMID: 21173275).

 What is the molecular weight of TOM20? 

 It is a short 16.3 kDa protein containing several highly conserved regions, including the transmembrane segment, the ligand-binding domain, and flexible segments at the N terminus and the C terminus of the protein crucial for its function (PMID: 15733919).

 What is the subcellular localization of TOM20?

 It specifically localizes in the mitochondrial outer membrane. In malignant cells, strong granular staining in the cytoplasm has been observed.

 What is the tissue specificity of TOM20?

 It is ubiquitously expressed in various tissues, with a particularly high expression in the brain, thyroid, and pancreas.

 What is the function of TOM20 in the mitochondrial membrane?

 Mitochondrial preproteins are generally synthesized in the cytoplasm with signal or targeting sequences, which are recognized by specific receptors on the outer mitochondrial membrane. TOM20, as one of the components of the TOM40 complex, specifically recognizes pre-sequences on target proteins or their unfolded forms. In addition to its translocase activity, TOM20 may act as a chaperone preventing these proteins from aggregation at the surface of mitochondria (PMID: 14699115).

 What is TOM20's involvement in disease?

 Diseases linked to the misregulation of TOM20 include Perry Syndrome and neurodegeneration with brain iron accumulation 2A. Numerous studies also associate deregulation of TOM20 with an array of mitochondrial dysfunctions and mitophagy defects (PMIDs: 30254015, 30160596).