Tested Applications
| Positive WB detected in | A431 cells, T-47D cells, L02 cells, Raji cells, HeLa cells, HEK-293 cells, HepG2 cells, K-562 cells, Jurkat cells | 
| Positive IHC detected in | human kidney tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
| Positive FC (Intra) detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
| IF | See 1 publications below | 
Product Information
66562-1-Ig targets TOM22 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag1797 Product name: Recombinant human TOMM22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC009363 Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Predict reactive species | 
                                    
| Full Name | translocase of outer mitochondrial membrane 22 homolog (yeast) | 
| Calculated Molecular Weight | 15 kDa | 
| Observed Molecular Weight | 22 kDa | 
| GenBank Accession Number | BC009363 | 
| Gene Symbol | TOMM22/Tom22 | 
| Gene ID (NCBI) | 56993 | 
| RRID | AB_2881923 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q9NS69 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Tom22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig recognises the 22 kDa protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TOM22 antibody 66562-1-Ig | Download protocol | 
| IHC protocol for TOM22 antibody 66562-1-Ig | Download protocol | 
| WB protocol for TOM22 antibody 66562-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Science Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex. | ||
Nat Commun Neutrophils restrain sepsis associated coagulopathy via extracellular vesicles carrying superoxide dismutase 2 in a murine model of lipopolysaccharide induced sepsis | ||
bioRxiv Novel reporter of the PINK1-Parkin mitophagy pathway identifies its damage sensor in the import gate | 



















