CoraLite® Plus 488-conjugated TOM22 Monoclonal antibody

TOM22 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66562
Clone No.1C2B11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, FC (Intra)

TOMM22, 1C2B11, 1C9 2, hTom22, MST065

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66562 targets TOM22 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1797

Product name: Recombinant human TOMM22 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC009363

Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Predict reactive species
Full Name translocase of outer mitochondrial membrane 22 homolog (yeast)
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC009363
Gene Symbol TOMM22/Tom22
Gene ID (NCBI) 56993
RRIDAB_2883356
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS69
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TOMM22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig recognises  the  22 kDa  protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TOM22 antibody CL488-66562Download protocol
IF protocol for CL Plus 488 TOM22 antibody CL488-66562Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...