Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells | 
| Positive FC (Intra) detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66562 targets TOM22 in WB, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag1797 Product name: Recombinant human TOMM22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC009363 Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI Predict reactive species | 
                                    
| Full Name | translocase of outer mitochondrial membrane 22 homolog (yeast) | 
| Calculated Molecular Weight | 15 kDa | 
| Observed Molecular Weight | 22 kDa | 
| GenBank Accession Number | BC009363 | 
| Gene Symbol | TOMM22/Tom22 | 
| Gene ID (NCBI) | 56993 | 
| RRID | AB_2920005 | 
| Conjugate | CoraLite®594 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q9NS69 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
TOMM22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig recognises the 22 kDa protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 TOM22 antibody CL594-66562 | Download protocol | 
| WB protocol for CL594 TOM22 antibody CL594-66562 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



