CoraLite®594-conjugated TOM22 Monoclonal antibody

TOM22 Monoclonal Antibody for WB, FC (Intra)
Cat No. CL594-66562
Clone No.1C2B11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, FC (Intra)

TOMM22, 1C2B11, 1C9 2, hTom22, MST065

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66562 targets TOM22 in WB, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1797

Product name: Recombinant human TOMM22 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC009363

Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Predict reactive species
Full Name translocase of outer mitochondrial membrane 22 homolog (yeast)
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC009363
Gene Symbol TOMM22/Tom22
Gene ID (NCBI) 56993
RRIDAB_2920005
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS69
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TOMM22 is a central receptor component of the translocase of the outer membrane of mitochondria responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. It is showed in UniProt that phosphorylation is performed at three positions of this protein which may increase the molecular weight. Catalog#66562-1-Ig recognises  the  22 kDa  protein larger than the calculated MW which is 15 kDa. Besides, it has been reported the MV of TOMM22 is 22 kDa (PMID:19285029).

Protocols

Product Specific Protocols
WB protocol for CL594 TOM22 antibody CL594-66562Download protocol
FC protocol for CL594 TOM22 antibody CL594-66562Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...