TOMM40 Monoclonal antibody

• 

  WB analysis of HeLa using 66658-1-Ig

  WB result of TOMM40 antibody (66658-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TOMM40 transfected HeLa cells.

• 

  WB analysis using 66658-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

• 

  WB analysis of HEK-293 using 66658-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 66658-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 66658-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 66658-1-Ig

  pig brain tissue, rat brain tissue, and mouse brain tissue were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66658-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66658-1-Ig (TOMM40 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 66658-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66658-1-Ig (TOMM40 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 66658-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 66658-1-Ig (TOMM40 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 66658-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 66658-1-Ig (TOMM40 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HepG2 using 66658-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 66658-1-Ig (TOMM40 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

TOMM40 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66658-1-Ig

Clone No.5E2C5

Publications(11)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TOM40, 5E2C5, C19orf1, D19S1177E, p38.5

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, human brain tissue, pig brain tissue, Jurkat cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW264.7 cells, K-562 cells, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

66658-1-Ig targets TOMM40 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13065

  Product name: Recombinant human TOMM40 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-361 aa of BC017224

  Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

• Full Name: translocase of outer mitochondrial membrane 40 homolog (yeast)
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC017224
• Gene Symbol: TOMM40
• Gene ID (NCBI): 10452
• RRID: AB_2882015
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O96008
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex.; Authors - Qiang Wang
human	WB	Mol Cell; Dynamic Regulation of Mitochondrial Import by the Ubiquitin System.; Authors - Lilian Phu
mouse	WB,IF	Cell Death Differ; Tufm lactylation regulates neuronal apoptosis by modulating mitophagy in traumatic brain injury; Authors - Weiji Weng
human	WB	Elife; Hepatic conversion of acetyl-CoA to acetate plays crucial roles in energy stress; Authors - Jinyang Wang
mouse	WB	Sci Signal; A genome-wide screen uncovers multiple roles for mitochondrial nucleoside diphosphate kinase D in inflammasome activation.; Authors - Orna Ernst
rat	WB	Apoptosis; Lactate accelerates vascular calcification through NR4A1-regulated mitochondrial fission and BNIP3-related mitophagy.; Authors - Yi Zhu