TOMM6 Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 16689-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16689-1-AP (TOMM6 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 16689-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 16689-1-AP (TOMM6 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 16689-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16689-1-AP (TOMM6 antibody) at dilution of 1:50 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 16689-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16689-1-AP (TOMM6 antibody) at dilution of 1:50 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TOMM6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16689-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

OBTP, TOM6, TOMM6

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16689-1-AP targets TOMM6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10037

  Product name: Recombinant human TOMM6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-74 aa of BC018624

  Sequence: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV

• Full Name: translocase of outer mitochondrial membrane 6 homolog (yeast)
• Calculated Molecular Weight: 74 aa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC018624
• Gene Symbol: TOMM6
• Gene ID (NCBI): 100188893
• RRID: AB_2240919
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96B49
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOMM6, also named as OBTP and TOM6, is a part of the preprotein translocase complex of the outer mitochondrial membrane (TOM complex).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Adv Sci (Weinh); SENP6 Maintains Mitochondrial Homeostasis by Regulating Mitochondrial Protein Import Through deSUMOylation of TOM40; Authors - Liubing Hu