TOP3B Polyclonal antibody

• 

TOP3B Polyclonal Antibody for ELISA

Cat No. 20301-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

DNA topoisomerase 3 beta 1, DNA topoisomerase III beta 1, TOP3B, TOP3B1, topoisomerase (DNA) III beta

---

Product Information

20301-1-AP targets TOP3B in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14115

  Product name: Recombinant human TOP3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 510-702 aa of BC002432

  Sequence: TDASIPVHINNICQRNYVTVESGRRLKPTNLGIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYRQVLGHTLDVFKRKFHYFVDSIAGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYIQAKPSRLHCSHCDETYTLPQNGTIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKK

• Full Name: topoisomerase (DNA) III beta
• Calculated Molecular Weight: 862 aa, 97 kDa
• GenBank Accession Number: BC002432
• Gene Symbol: TOP3B
• Gene ID (NCBI): 8940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95985
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.