Use Able AI chat for product recommendations

TOPBP1 Polyclonal antibody, PBS Only

TOPBP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23340-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

23340-1-PBS targets TOPBP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18961

Product name: Recombinant human TOPBP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-335 aa of BC126209

Sequence: MHHQRCVPRAEHPVYNMVMSDVTISCTSLEKEKREEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLKKPILLPSWIKTLWEKSQEKKITRYTDINMEDFKCPIFLGCIICVTGLCGLDRKEVQQLTVKHGGQYMGQLKMNECTHLIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKGFCQDESIYKTEPRPEAKTMPNSSTPTSQINTIDSRTLSDVSNISNINASCVSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVV

Predict reactive species
Full Name topoisomerase (DNA) II binding protein 1
Calculated Molecular Weight 1522 aa, 171 kDa
Observed Molecular Weight 171 kDa
GenBank Accession NumberBC126209
Gene Symbol TOPBP1
Gene ID (NCBI) 11073
RRIDAB_2879258
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ92547
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human DNA topoisomerase II binding protein 1 (TopBP1) contains eight BRCT motifs that are found in proteins regulating the DNA damage response, transcription, and replication (1). In addition, TopBP1 shares sequence similarity with the fission yeast Rad4/Cut5 protein and the budding yeast DPB11 protein, both of which are required for DNA damage control and/or replication checkpoint control (2,3). Phosphorylation of TopBP1 occurs in response to DNA double-strand breaks and replication blocks (2). TopBP1 forms nuclear foci and localizes to the sites of DNA damage or the arrested replication forks (2,3). Downregulation of TopBP1 leads to reduced cell survival, probably due to increased apoptosis (2). TopBP1 functions as a transcriptional coactivator by enhancing the human papillomavirus (HPV) transcription/replication factor E2 (1). In addition, the HECT-domain ubiquitin ligase, hHYD, cooperates with TopBP1 in DNA damage response (4). TopBP1 specifically interacts with the C-terminal region of topoisomerase II beta, which suggests a supportive role for TopBP1 in the catalytic reactions of topoisomerase II beta through transient breakages of DNA strands (5). The gene encoding TopBP1 maps to chromosome 3q22.2 (5).

Loading...
||
New chat

Able

正在加载,请稍候...