TOR1B Recombinant monoclonal antibody, PBS Only (Detector)

TOR1B Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84267-3-PBS
Clone No.241574A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

241574A7, DQ1, Torsin 1B, Torsin family 1 member B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84267-3-PBS targets TOR1B as part of a matched antibody pair:

MP01175-1: 84267-1-PBS capture and 84267-3-PBS detection (validated in Cytometric bead array)

MP01175-2: 84267-2-PBS capture and 84267-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16641

Product name: Recombinant human TOR1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-77 aa of BC015578

Sequence: FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF

Predict reactive species
Full Name torsin family 1, member B (torsin B)
Calculated Molecular Weight 336 aa, 38 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC015578
Gene Symbol TOR1B
Gene ID (NCBI) 27348
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14657
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Torsin A is 1 of 4 predicted mammalian torsin ATPases associated with assorted cellular activities (AAA+) proteins (PMID: 20015956). TOR1B (torsin family 1 member B), also called TorsinB (TorB), is similar to TorsinA at the sequence level. TorsinA and TorsinB are both ubiquitously expressed in all cell types though TorsinA is more highly expressed in neurons. TorsinA and TorsinB may be somewhat functionally redundant, with TorsinA being more important in neuronal cells and TorsinB being more important in other tissues (PMID: 24275647). TOR1B serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins,and plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity (PMID: 24275647; 23569223).

Loading...
||
New chat Able
正在加载,请稍候...