TOR3A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TOR3A Polyclonal antibody (10647-1-AP)

• Featured Product
• KD/KO Validated

TOR3A Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 10647-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, CoIP, ELISA

Synonyms

ADIR, ADIR2, ATP-dependent interferon-responsive protein, Torsin 3A, Torsin family 3 member A

• 

  WB analysis of HEK-293 using 10647-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10647-1-AP (TOR3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10647-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10647-1-AP (TOR3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10647-1-AP

  WB result of TOR3A antibody (10647-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TOR3A transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10647-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10647-1-AP (TOR3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 10647-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using 10647-1-AP (TOR3A antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TOR3A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, Raji cells, PC-3 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10647-1-AP targets TOR3A in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1012

  Product name: Recombinant human TOR3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-397 aa of BC007571

  Sequence: YLDLLTTWYCSFKDCCPRGDCRISNNFTGLEWDLNVRLHGQHLVQQLVLRTVRGYLETPQPEKALALSFHGWSGTGKNFVARMLVENLYRDGLMSDCVRMFIATFHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPEGHRAESPWTIFLFLSNLRGDIINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS

• Full Name: torsin family 3, member A
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 39-42 kDa, 46-52 kDa
• GenBank Accession Number: BC007571
• Gene Symbol: TOR3A
• Gene ID (NCBI): 64222
• RRID: AB_2303598
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H497
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TOR3A Polyclonal antibody (Cat# 10647-1-AP) has 1 citation to date. It was cited in Emerging Microbes & Infections (IF: 7) in a 2026 study by Xiaoping Li et al., which investigated TOR3A's role in repressing type I interferon production and limiting viral clearance during respiratory syncytial virus infection. The research field is virology and innate immune signaling. The antibody was used in WB and CoIP applications with human and mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,CoIP	Emerg Microbes Infect; TOR3A represses type I interferon production and limits viral clearance during respiratory syncytial virus infection.; Authors - Xiaoping Li ; KO Validated