TOX3 Polyclonal antibody

• 

  WB analysis using 28338-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28338-1-AP (TOX3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TOX3 Polyclonal Antibody for WB, ELISA

Cat No. 28338-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CAGF9, TNRC9

---

Tested Applications

• Positive WB detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28338-1-AP targets TOX3 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28251

  Product name: Recombinant human TOX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of NM_001080430

  Sequence: MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSG

• Full Name: TOX high mobility group box family member 3
• Calculated Molecular Weight: 63 aa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: NM_001080430
• Gene Symbol: TOX3
• Gene ID (NCBI): 27324
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15405
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOX3, also known as TNRC9 (trinucleotide repeat containing 9), is a neuronal transcription factor containing a nuclear localization signal and a high mobility group (HMG)-box domain followed by a C-terminal poly-glutamine stretch. TOX3 is specifically expressed in the estrogen receptor alpha positive (ER+) subset of murine mammary luminal epithelial cells, including a recently identified progenitor cell subset (PMID: 19196971). TOX3 expression is negatively correlated with the immunotherapy targets PD-1, PD-L1 and HAVCR2 in lung adenocarcinoma, indicating that it serves a role in immunity activation (PMID: 27080130).