TOX4 Polyclonal antibody

TOX4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 27988-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

TOX 4, MIG7, LCP1, C14orf92

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, K-562 cells, MCF-7 cells, PC-3 cells, Raji cells
Positive IHC detected inrat bladder tissue, mouse bladder tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27988-1-AP targets TOX4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27638

Product name: Recombinant human TOX4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 43-215 aa of BC013689

Sequence: SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR

Predict reactive species
Full Name TOX high mobility group box family member 4
Calculated Molecular Weight 621 aa, 66 kDa
Observed Molecular Weight100-110 kDa
GenBank Accession NumberBC013689
Gene Symbol TOX4
Gene ID (NCBI) 9878
RRIDAB_3086019
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94842
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOX (Thymocyte selection-associated HMG bOX) genes represent a novel gene family and encode a novel nuclear DNA binding protein belonging to a large superfamily of HMG (high mobility group)-box family. TOX proteins consist a small subfamily of proteins, including TOX1, TOX2, TOX3, and TOX4. The TOX subfamily members are highly conserved among vertebrates. TOX4 was recently found to be one of the subunits of the PP1C, which consists of three regulatory proteins, PNUTS, TOX4, and WDR82, and one of the PP1 phosphatases, PP1α, β, andγ25. Tox4 can modulate cell fate by reprogramming from a somatic state into a pluripotent and neuronal fate (PMID:31519808). Despite a predicted molecular mass of TOX4 protein of 66 kDa, the detection band of western blot analysis in many literatures is 100 kDa (PMID:37286708;35365735). This antibody was also detected at around 100 kda.

Protocols

Product Specific Protocols
WB protocol for TOX4 antibody 27988-1-APDownload protocol
IHC protocol for TOX4 antibody 27988-1-APDownload protocol
IF protocol for TOX4 antibody 27988-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Mol Cell

The phosphatase PP1 sustains global transcription by promoting RNA polymerase II pause release

Authors - Zhenning Wang
Loading...
||
New chat Able
正在加载,请稍候...